On The Map Marketing: all proof and data on file
Every case, review and source Vendar holds, grouped by need. Filter by need, by work done, or by items checked against their source.
Every proof item on file for On The Map Marketing: who said it, where and when.
- SEO Agencies within a $6,000 Monthly Budget3/40
- SEO Agencies on a Monthly Retainer3/40
- SEO Agencies with an In-house Team3/40
- SEO for High-Ticket Services2/15
- SEO for Lead Generation0/11
- Ecommerce SEO1/5
- Technical SEO0/4
- Local SEO0/3
- Small Business0/1
- Content-led SEO0/1
- onthemap.com48
- savvylawfirmmarketing.com3
- glassdoor.com3
- delphi.ai3
- no URL on file1
Nothing matches these filters.
SEO Agencies within a $6,000 Monthly Budget
40On The Map Marketing documented a case study for Roberts Law Firm, a personal injury firm in Orange County, California, showing growth in Domain Rating, organic traffic, traffic value and leads over just over 18 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Roberts Law Firm signed a Local Domination package with On The Map Marketing in January 2022. … In a little over 18 months, they’ve seen a massive boost in Domain Rating, organic traffic, traffic value, as well as perhaps the most important metric of all, new leads. … In August 2023, their website was seeing an average of 1,797 visitors a day, a 907% increase in just over 18 months!
Mike Agruss Law, a personal injury firm in Illinois, says On The Map built the firm a new WordPress website and has managed its SEO campaign for over three years, delivering leads and tracked signed cases with weekly meetings on ROI.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
I've been working with On The Map for 3+ years. On The Map built my law firm a brand-new WordPress Website and has been managing my SEO campaign for years. Not only does On The Map deliver quality leads through it SEO efforts, but On The Map is 100% transparent with what they do and how they do it.
On The Map Marketing reports a case study stating that Roberts Law Firm achieved a 150% increase in organic leads in 18 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO for Lead GenerationSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How Roberts Law Firm Achieved a 150% Increase in Organic Leads in 18 Months
On The Map Marketing reports a case study stating that Law.ninja achieved a 152% increase in organic traffic in 8 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How Law.ninja Achieved a 152% Increase in Organic Traffic in 8 Months
For Miami Top Cleaning, On The Map Marketing reported +164.71% organic traffic and +118% form submissions in 12 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Key Results : +164.71% organic traffic and +118% form submissions in 12 months
Show 35 moreShow fewer
Miami Top Cleaning's email lead generation doubled from about 11 to about 24 per month from organic search.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Lead generation via email doubled, from ~11 to ~24 per month, purely from organic search.
GWSPressureCleaning.com achieved +621% organic traffic in 13 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How GWSPressureCleaning.com Achieved +621% Organic Traffic in 13 Months
Within a few months of On The Map Marketing's SEO campaign, Wagner Reese's referring domains increased to more than 400 and organic traffic grew to 6,000 monthly visitors, with lead quality improving while overall lead volume remained roughly the same.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Within a few months of On The Map Marketing's targeted SEO campaign, Wagner Reese's referring domains increased to more than 400, and organic traffic grew to 6,000 monthly visitors. While the overall lead volume remained roughly the same, the quality of those leads improved significantly.
Ulysses Gonzalez, President of Miami Top Cleaning Service, said On The Map Marketing's SEO services more than covered the costs 10x.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
The results from their services have more than covered the costs 10x.
On The Map Marketing reports a case study titled 'How Wagner Reese Achieved a 14.53x ROI With Targeted SEO', indicating an SEO engagement for client Wagner Reese that produced a 14.53x ROI. No time period for the result is stated on the page.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How Wagner Reese Achieved a 14.53x ROI With Targeted SEO
On The Map Marketing reports a case study titled 'How Hipskind & McAninch Scaled Case Revenue by 18.6x With SEO', indicating an SEO engagement for client Hipskind & McAninch that scaled case revenue by 18.6x. No time period for the result is stated on the page.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How Hipskind & McAninch Scaled Case Revenue by 18.6x With SEO
Miami Top Cleaning's president says the results of On The Map's work on the company's website and SEO have more than covered the costs 10x.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
I'm happy that On The Map Marketing has done the same for our website and SEO. The results have more than covered the costs 10x.
FilterKing crossed $460k in revenue via ecommerce SEO.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedEcommerce SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How FilterKing Crossed $460k in Revenue via Ecommerce SEO
1800-Injured reached top-3 rankings for “Car Accident Lawyer” terms.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How 1800-Injured Reached Top-3 Rankings for “Car Accident Lawyer” Terms
On The Map Marketing's own case study for GWS Pressure Cleaning, a "family-owned business that has served Miami's residential and commercial properties for years", describes a website redesign together with technical SEO fixes, keyword research and link building. Reported over 13 months (October 2021 to November 2022): organic traffic +621%, form submissions and calls up 30% (23 to 30 inquiries a month), and top-four rankings in Miami for core service keywords. The page does not separate the effect of the redesign from SEO.
agency's own wordsonthemap.com · seen Sep 2026 · checked Nov 2026result from 2022, older than 3 yearsTechnical SEOSmall BusinessSEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Professional Website Redesign: Revamped site architecture to highlight each service and location (Miami, Doral, etc.) … Holistic SEO Strategy: Implemented technical SEO fixes, conducted keyword research, and built authoritative links with the goal of ranking for “pressure cleaning” and related topics … Within 13 months (October 2021, November 2022) of starting the campaign, GWS broke into page one for a lot of relevant keywords.
On The Map Marketing's own ecommerce SEO case study for Filter King, an online store on a custom Laravel/PHP site selling household air and furnace filters, describes keyword mapping across four product silos, internal linking with automated category widgets, content rewrites and link building. Organic visitors grew from 447 a month in January 2019 to over 25,000 a month, with over 17,400 ranking keywords and revenue past $460,000. The case study notes Google Ads ran at the same time, so the revenue is not attributed to SEO alone.
agency's own wordsonthemap.com · seen Sep 2026 · checked Nov 2026result from 2019, older than 3 yearsTechnical SEOEcommerce SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
We crossed $460k in revenue as a result of our Ecommerce SEO efforts. Here’s a Google Analytics screenshot depicting the same: We met a traffic plateau in between. However, we overcame some challenges to scale our store to over 25k visitors per month with our Ecommerce site, where we sold household commodities such as AC and furnace filters, ranking for over 17.4k keywords:
On The Map Marketing built and promoted its own e-commerce store, Filter King, selling AC and furnace filters, and reports crossing $460k in revenue from its Ecommerce SEO efforts, scaling the site to over 25k visitors per month and rankings for over 17.4k keywords. The page notes the results were achieved while also investing in Google Ads alongside SEO, so they are not attributable to SEO alone.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026result from 2020, older than 3 yearsEcommerce SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
We crossed $460k in revenue as a result of our Ecommerce SEO efforts. ... we overcame some challenges to scale our store to over 25k visitors per month with our Ecommerce site, where we sold household commodities such as AC and furnace filters, ranking for over 17.4k keywords: ... We achieved the impressive results above, starting from scratch while simultaneously investing in Google ads besides SEO.
On The Map Marketing’s SEO campaign for GWS Pressure Cleaning increased organic traffic by 621.05% over 13 months, from October 2021 to November 2022.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026result from 2022, older than 3 yearsSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Within 13 months (October 2021, November 2022) of starting the campaign, GWS broke into page one for a lot of relevant keywords. Here’s how their performance looked like: +621.05% Organic Traffic Monthly organic visitors surged over the 13-month campaign.
On The Map Marketing’s website design and SEO work for GWS Pressure Cleaning increased form submissions and calls by 30%; monthly inquiries rose from 23 to 30.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026result from 2022, older than 3 yearsSEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
+30% Form Submissions & Calls Lead volume climbed from 23 inquiries per month to 30.
On The Map Marketing's own case study for a Wyoming personal-injury law firm describes on-site optimisation, page-speed work, consistent NAP data across local citations, backlink cleanup and a restructured content hub. Within about three months the firm ranked first on page one for "Wyoming wrongful death attorney" and fourth for "Wyoming personal injury lawyer".
agency's own wordsonthemap.com · seen Sep 2026 · checked Nov 2026Local SEOSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
RESULTS RESULTS RESULTS! We achieved page one position one for keyword "Wyoming wrongful death attorney" and page one position 4 for "Wyoming personal injury lawyer"! The entire process took about three months to achieve, which exceeded our expectations! … In the case of this client, we needed to actually remove/disavow some links that were harming the website. Once we cleaned those up, we allocated some guest posts. … Aside from link-building, we also worked on local citation improvement . This is also a crucial point as we were aiming for LOCAL ranking results. Consequently, it is important to have consistent NAP+W throughout all local citations.
Wagner Reese, LLP's CMO says On The Map helped refine the firm's SEO strategy, improve search rankings, and ensure incoming leads were the right fit for the firm.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Not only have they helped us refine our SEO strategy and improve our search rankings, but they've also ensured that the leads coming in are the right fit for our firm.
Samantha Pearson, Chief Marketing Officer at Wagner Reese, LLP, said the agency refined the firm's SEO strategy, improved search rankings, and improved the quality of incoming leads.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Working with OTM has been a game-changer for our law firm. Not only have they helped us refine our SEO strategy and improve our search rankings, but they've also ensured that the leads coming in are the right fit for our firm.
The Filter King site drove organic search traffic of 447 in January 2019 after the initial link building ramp-up.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026result from 2019, older than 3 yearsSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Soon enough, we drove organic search traffic of 447 to our website in January 2019:
Home Care Contractors, a home service business in Washington state, hired On The Map to build its website and run SEO, and one year later reports the business is doing better than imagined.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Opened a Home service business in Washington state. Interviewed multiple people to build our website and run SEO. Andrew and his team stood out to us the most. One year later, our business is doing better than I imagined.
Samantha Pearson, CMO at Wagner Reese, LLP, testifies that On The Map helped the firm refine its SEO strategy, improve search rankings, and attract better-fitting leads.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for Lead GenerationSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Working with OTM has been a game-changer for our law firm. Not only have they helped us refine our SEO strategy and improve our search rankings, but they’ve also ensured that the leads coming in are the right fit for our firm.
On The Map Marketing's Filter King engagement included technical SEO work to improve the site experience alongside content and links.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026Technical SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
While we pushed for better content and links, we didn’t ignore technical SEO.
On The Map Marketing provided website design, organic SEO, and local SEO for Miami Top Cleaning.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026Local SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Service Offered : Website Design, Organic and Local SEO
On The Map Marketing created local SEO content targeting office and janitorial cleaning searches for Miami Top Cleaning.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026Local SEOContent-led SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Local SEO content targeting office and janitorial cleaning searches
Gary Stewart, Owner of GWS Pressure Cleaning, said On The Map Marketing grew his website's presence over the last year and helped capture the Miami Pressure Washing Market.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
“On The Map Marketing has been steadily growing my website’s presence consistently over the last year, and I’m very happy with the results. We’ve captured the Miami Pressure Washing Market and we’re expanding from there bit by bit.”
For GWS Pressure Cleaning, On The Map Marketing implemented technical SEO fixes, keyword research, and link building. The campaign achieved top-4 rankings in Miami and surrounding areas for core service keywords.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026result from 2022, older than 3 yearsTechnical SEOSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Holistic SEO Strategy: Implemented technical SEO fixes, conducted keyword research, and built authoritative links with the goal of ranking for “pressure cleaning” and related topics Results Within 13 months (October 2021, November 2022) of starting the campaign, GWS broke into page one for a lot of relevant keywords. Here’s how their performance looked like: +621.05% Organic Traffic Monthly organic visitors surged over the 13-month campaign. +30% Form Submissions & Calls Lead volume climbed from 23 inquiries per month to 30. Multi-Location Visibility Achieved top-4 rankings in Miami and surrounding areas for core service keywords like “Miami pressure cleaning.”
Savvy Law Firm Marketing review of On The Map
outside sourcecheckedsavvylawfirmmarketing.com · seen Apr 2026 · checked Nov 2026SEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
On the Map Marketing Review (2026): Pros, Cons & Services … An Introduction to On The Map Marketing On the Map marketing is a lawyer marketing agency providing digital marketing services such as SEO, link-building and PPC.
Savvy Law Firm Marketing published a review of On the Map Marketing and discloses that it competes with the vendor.
outside sourcecheckedsavvylawfirmmarketing.com · seen Nov 2026 · checked Nov 2026SEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
On the Map Marketing Review (2026): Pros, Cons & Services … Editorial Disclosure: Savvy Law Firm Marketing competes with On the Map Marketing.
The page is a 2026 review of On the Map Marketing titled On the Map Marketing Review (2026): Pros, Cons & Services.
outside sourcecheckedsavvylawfirmmarketing.com · seen Nov 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
On the Map Marketing Review (2026): Pros, Cons & Services … This review was written by Rob Edwards and last fact-checked on July 20, 2026.
On The Map Marketing presents itself as a law firm SEO agency and documents law firm SEO client case studies, including How Wagner Reese Achieved a 14.53x ROI With Targeted SEO.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
We are a law firm SEO agency: our in-house attorney SEO experts grow organic traffic, qualified leads and signed cases for ambitious law firms. … Here’s a few of our client success stories demonstrating our legal SEO expertise: How Wagner Reese Achieved a 14.53x ROI With Targeted SEO … How Hipskind & McAninch Scaled Case Revenue by 18.6x With SEO
On The Map Marketing describes itself as a law firm SEO agency and documents client success stories and published law firm SEO case studies, including Wagner Reese’s 14.53x ROI and 1,353% ROI results.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedSEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Law Firm SEO Agency & Attorney SEO Experts We are a law firm SEO agency: our in-house attorney SEO experts grow organic traffic, qualified leads and signed cases for ambitious law firms. … Here’s a few of our client success stories demonstrating our legal SEO expertise: How Wagner Reese Achieved a 14.53x ROI With Targeted SEO View Case Study … More Law Firm SEO Results Beyond the two campaigns above, these law firm SEO case studies are published in full on our site: How Wagner Reese achieved a 1,353% ROI with targeted SEO
On The Map documents case studies of client work, including SEO results for Wagner Reese and Miami Top Cleaning.
agency's own wordsonthemap.com · seen Apr 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
How Wagner Reese Achieved a 1353% ROI with Targeted SEO … How Miami Top Cleaning Achieved a 1,000% ROI from SEO
The page documents On The Map Marketing testimonials, including work for Mike Agruss Law involving a new WordPress website and ongoing SEO management for 3+ years.
agency's own wordsonthemap.com · seen Apr 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
On The Map Marketing Reviews … I’m a personal injury lawyer in Illinois. I’ve been working with On The Map for 3+ years. On The Map built my law firm a brand-new WordPress Website and has been managing my SEO campaign for years. … Michael Agruss Founder & CEO of Mike Agruss Law
Law-firm SEO page highlights legal specialization and links to lawyer marketing case studies, including Wagner Reese and other firm examples.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for High-Ticket ServicesSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
Here’s a few of our client success stories demonstrating our legal SEO expertise: … How Wagner Reese Achieved a 14.53x ROI With Targeted SEO … View More Lawyer Marketing Case Studies
The page documents client testimonials about On The Map Marketing's SEO, website-building, and marketing work.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Teamopen sourceshow the quote
“Working with OTM has been a game-changer for our law firm. Not only have they helped us refine our SEO strategy and improve our search rankings, but they’ve also ensured that the leads coming in are the right fit for our firm.” … I had the good fortune of having Kara Kelley as my representative at On The Map. This was after many years of really bad SEO results from three prior prominent agencies. She and her team are hands down the most knowledgeable SEO people around. … On The Map built my law firm a brand-new WordPress Website and has been managing my SEO campaign for years.
Visible footprint across Miami service-business SEO comparisons and South Florida shortlist pages.
agency's own wordsno URL on fileSEO Agencies within a $6,000 Monthly BudgetSEO Agencies on a Monthly RetainerSEO Agencies with an In-house Team
SEO for High-Ticket Services
5On The Map Marketing reports a case study stating that R + R Dental achieved an 890% increase in conversions in eight months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
How R + R Dental Achieved an 890% Increase in Conversions in Eight Months
A case study describes a dental office in New York that boosted conversions by 890% using On the Map's PPC services; the result covers PPC, not SEO.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
Dental Office in NY Boosted Conversions by 890% With On the Map's PPC Services
Official case-study library includes legal, dental, home services, PPC, PR, and SEO examples with named outcomes such as ROI, media placements, and retained cases.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for High-Ticket Servicesopen sourceshow the quote
Law Firm Marketing Case Studies … How Hansford McDaniel Achieved 80 Retained Cases With PPC in 12 Months … How Miami Top Cleaning Achieved a 1,000% ROI from SEO
On The Map's case-study hub lists dental, home services, and law firm case studies, including client work such as Wagner Reese's thought leadership PR and 844SeeMike's reactive PR.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for High-Ticket Servicesopen sourceshow the quote
Case Studies Dental Case Studies Home Services Marketing Case Studies Law Firm Marketing Case Studies … View Case Study How Wagner Reese Built Authority With Thought Leadership PR View Case Study How 844SeeMike Captured 738 Media Features With Reactive PR View Case Study
On The Map Marketing's page is titled “Case Studies” and lists dental and home services marketing case studies.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026SEO for High-Ticket Servicesopen sourceshow the quote
Dental Case Studies … Home Services Marketing Case Studies
SEO for Lead Generation
1On The Map Marketing reports a case study stating that Nunez Law generated 17 leads from PPC in 2 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
How Nunez Law Generated 17 Leads from PPC in 2 Months
Ecommerce SEO
2As Chief Executive Officer at On The Map, Inc., Kristaps Brencans launched a Shopify app that reached Staff Pick #1.
outside sourcecheckeddelphi.ai · seen Nov 2026 · checked Nov 2026Ecommerce SEOopen sourceshow the quote
Chief Executive Officer @ On The Map, Inc. Launched a Shopify app that hit Staff Pick #1
The results for Filter King combined SEO with simultaneous investment in Google ads, so the reported revenue is not attributable to ecommerce SEO alone.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026Ecommerce SEOopen sourceshow the quote
We achieved the impressive results above, starting from scratch while simultaneously investing in Google ads besides SEO.
Other work done
6Cases and reviews outside the needs Vendar ranks
On The Map Marketing reports a case study stating that Hansford McDaniel achieved 80 retained cases with PPC in 12 months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
How Hansford McDaniel Achieved 80 Retained Cases With PPC in 12 Months
Miami Top Cleaning's results more than covered costs 10x.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026year of result not statedopen sourceshow the quote
The results have more than covered the costs 10x
Kristaps Brencans, as Chief Executive Officer at On The Map, Inc., scaled the company's ARR from $3M to $7.3M and exited.
outside sourcecheckeddelphi.ai · seen Nov 2026 · checked Nov 2026year of result not statedopen sourceshow the quote
Chief Executive Officer @ On The Map, Inc. Scaled ARR from $3M to $7.3M and exited
Gary Stewart, owner of GWS Pressure Cleaning, said On The Map has been steadily growing his website's presence over the last year and that they captured the Miami Pressure Washing Market.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
“On The Map, Inc. has been steadily growing my website’s presence consistently over the last year, and I’m very happy with the results. We’ve captured the Miami Pressure Washing Market and we’re expanding from there bit by bit.”
John R. Fuller, P.C. says that after years of poor results from three prior agencies, On The Map got the firm to page one for multiple search terms in a few months.
agency's own wordsonthemap.com · seen Nov 2026 · checked Nov 2026show the quote
They got me to page one for multiple search terms in perhaps the most competitive field possible and most importantly, did so in just a few months.
Show 1 moreShow fewer
Portfolio entry: www.onthemap.com
agency's own wordsonthemap.com · checked Nov 2026
Services offered
4Service pages and pricing: what the agency sells, not what it has done
Kristaps Brencans served as a panelist for On The Map, Inc., speaking on emerging channels for law firms.
outside sourcecheckeddelphi.ai · seen Nov 2026 · checked Nov 2026show the quote
Panelist @ On The Map, Inc. Spoke on emerging channels for law firms
Glassdoor profile shows a 3.2 rating from 70 reviews.
outside sourcecheckedglassdoor.com · checked Nov 2026
Portfolio entry: On The Map Reviews E807450
outside sourcecheckedglassdoor.com · checked Nov 2026
Recent employee-review context is mixed and includes operational complaints, so buyers should validate delivery continuity and account ownership.
linked to the agencycheckedglassdoor.com · checked Nov 2026
Reviews from platforms that compete with Vendar are counted, but not linked; their sources are kept on file.
How complete and trustworthy this profile is
What stands behind the numbers, what is not collected yet, the AI feed, and how to correct the page.
- Who the company is: website, headquarters, founding year, team size, logo, regions served20/20
complete
- Fit: services, industries, client types15/15
complete
- Commercial terms: model, entry price, hourly rate, minimum term, setup fee20/20
complete
- Documented work: cases naming a client and a result (target 5) and work claims overall (target 10)30/30
24 cases with a named client and a result, 42 work claims
- Reputation: rating and review count on two or more platforms, each with 10 or more reviews8/15
1 platform with a rating and 10 or more reviews
- Who is speaking: independent sources among work claims (full marks at 40%)4/30
2 of 42 work claims are independent
- Checked against the source page: confirmed, or half for partly confirmed22/25
49 confirmed, 4 partly, of 57 with a source
- Numbers backed by a verbatim quote from the source20/20
23 of 23
- Seen within the last 365 days14/15
53 of 58
- Not contradicted: claims their source no longer supports9/10
1 not supported by their page
- Last verified
- Jun 2, 2026
- Re-check due
- Jan 31, 2027
The large number at the top is the score of the vendor's best position in a ranking: the number that orders it on that list. These two scores describe the profile itself and never change a position. Rules: how Vendar ranks.
The collector adds these as its passes come online. Until then they are gaps, not zeros.
- Cross-source consistency
Team size, founding year, address and prices compared across the site, LinkedIn, directories and registries. Arrives with the collector's evidence pass.
- Change history
What changed on the profile and how the score moved per question, with the model version. Arrives with the monthly fast pass.
- Case quality grades
Client specificity, baseline and result, scale, causality and verifiability graded 0 to 3 with quotes. Arrives with ranking model 2026.11 after calibration.
- Measurements and buyer reports
Speed and uptime of delivered sites, visibility of named clients, response time to a quote request, and what buyers report 30 and 90 days after a shortlist.
The same facts, limits and citations are served as JSON. Readiness: cite_with_source_context.
/ai/vendors/on-the-map-marketing- 2 of 42 documented work claims come from independent sources; the rest are the agency's own account or sources it controls.
- Specialization depth varies by vertical and budget band.
- Commercial fit should still be confirmed directly before final shortlisting.
- Do not infer headquarters from service-area coverage.
- Do not treat paid visibility as organic ranking proof.
- Do not present a source-thin profile as independently verified.
On The Map Marketing can dispute any claim on this page or add evidence. Submitted evidence is recorded as claimed until Vendar checks it, and the dispute and its resolution stay on the profile. Buyers who spot an error can report it the same way.
Submit a correction or evidencePaid visibility never changes the content or the order of this page. Where a vendor has an active package it is disclosed below.